Transcript | Ll_transcript_490623 |
---|---|
CDS coordinates | 279-1025 (+) |
Peptide sequence | MKEKEDENASKNTIIDSRKMRTPDVKYVSAHFNTVGGNNVVVIPKRTSNVNSTKKSNINAKKMRNNDVRYVSAYFNTVPEKNVIIIPKRPRMKNENENEVENNTNIIYVSAYFDYSKIRTKNVVVIPPRAKKNESEMIDMYNHIKPLKSLPSELCSDAYRRKTDTNTWKPPESLFRFEPLLQEYYTYDPWRILVTSVLLNLTTGVQVRRVLSNLFSLCPNAKSCIEVEVEEIEQVIRTLGLQNTTLIT* |
ORF Type | complete |
Blastp | Methyl-CpG-binding domain protein 4-like protein from Arabidopsis with 37.07% of identity |
---|---|
Blastx | Methyl-CpG-binding domain protein 4-like protein from Arabidopsis with 38.05% of identity |
Eggnog | Methyl-CpG binding domain protein(ENOG4111HPQ) |
Kegg | Link to kegg annotations (AT3G07930) |
CantataDB | Link to cantataDB annotations (CNT0000576) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458151.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer