Protein coding transcript 87857

• Transcript: Ll_transcript_490631
• CDS coordinates: 3-824 (+)
• Peptide sequence: HFNTVGGHNVVVIPKRTSNVNSTKKSNINAKKMRNNDVRYVSAYFNTVPEKNVIIIPKRPRMKNENENEVENNTNIIYVSAYFDYSKIRTKNVVVIPPRAKKNESEMIDMYNHIKPLKSLPSELCSDAYRRKTDTNTWKPPESLFRFEPLLQEYYTYDPWRILVTSVLLNLTTGVQVLRVLSNLFSLCPNAKSCIEVEVEEIEQVIRSLGLQNKRAKALQRLSHEYLYGSWTHVTQLHGVGKYVGDAYAIFCTGEWRNVTPTDKELLCYWNFL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_490631

• Blastp: Methyl-CpG-binding domain protein 4-like protein from Arabidopsis with 43.4% of identity
• Blastx: Methyl-CpG-binding domain protein 4-like protein from Arabidopsis with 43.82% of identity
• Eggnog: Methyl-CpG binding domain protein(ENOG4111HPQ)
• Kegg: Link to kegg annotations (AT3G07930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458151.1)
• Pfam: HhH-GPD superfamily base excision DNA repair protein (PF00730.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;