Protein coding transcript 87896

• Transcript: Ll_transcript_346025
• CDS coordinates: 2-649 (+)
• Peptide sequence: QLDGTVNEWGWCKQKLGANAILAVSLAVCKAGALVKKIPLYKHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKEAMKMGVEVYHNLKSVIKKKYGQDATNVGDEGGFAPNIQENKEGLELLKTAIAKAGYTGKVVIGMDVAASEFYDNKDKTYDLNFKEENNDGSEKISGDSLKNVYKSFVADYPIVSIEDPFDQDDWEH
• ORF Type: internal

Annotations of Ll_transcript_346025

• Blastp: Enolase from Oryza sativa with 93.52% of identity
• Blastx: Enolase from Oryza sativa with 93.52% of identity
• Eggnog: Catalyzes the reversible conversion of 2- phosphoglycerate into phosphoenolpyruvate. It is essential for the degradation of carbohydrates via glycolysis (By similarity)(COG0148)
• Kegg: Link to kegg annotations (4348176)
• CantataDB: Link to cantataDB annotations (CNT0002948)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453236.1)
• Pfam: Enolase, N-terminal domain (PF03952.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;