Transcript | Ll_transcript_344190 |
---|---|
CDS coordinates | 411-1085 (+) |
Peptide sequence | MARNPKVVAAYSAMANLGIHVSKVKPVLKKLLKLYDKNWELIEEENYRALADAIFEEDENKVPESEPEPVHKKKNKRVDEGRADDEEAHLHDEPLQPLKRSRLRGQETQSLHPSTSSGPSSAAYPLKVPKLEDGTVPESSNGRQHQNTAVLSDGNAQNETNQLPPRDGIVDKGKQPVSPNVTYRRRRLTSERAAPAVPLIIPKDEPIDDMPQFAVPVTMILPGI* |
ORF Type | complete |
Blastp | Probable inactive histone-lysine N-methyltransferase SUVR2 from Arabidopsis with 39.73% of identity |
---|---|
Blastx | Probable inactive histone-lysine N-methyltransferase SUVR2 from Arabidopsis with 43.7% of identity |
Eggnog | Histone-lysine N-methyltransferase(COG2940) |
Kegg | Link to kegg annotations (AT5G43990) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429978.1) |
Pfam | Ubiquitin-binding WIYLD domain (PF10440.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer