Protein coding transcript 87917

• Transcript: Ll_transcript_344190
• CDS coordinates: 411-1085 (+)
• Peptide sequence: MARNPKVVAAYSAMANLGIHVSKVKPVLKKLLKLYDKNWELIEEENYRALADAIFEEDENKVPESEPEPVHKKKNKRVDEGRADDEEAHLHDEPLQPLKRSRLRGQETQSLHPSTSSGPSSAAYPLKVPKLEDGTVPESSNGRQHQNTAVLSDGNAQNETNQLPPRDGIVDKGKQPVSPNVTYRRRRLTSERAAPAVPLIIPKDEPIDDMPQFAVPVTMILPGI*
• ORF Type: complete

Annotations of Ll_transcript_344190

• Blastp: Probable inactive histone-lysine N-methyltransferase SUVR2 from Arabidopsis with 39.73% of identity
• Blastx: Probable inactive histone-lysine N-methyltransferase SUVR2 from Arabidopsis with 43.7% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT5G43990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429978.1)
• Pfam: Ubiquitin-binding WIYLD domain (PF10440.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;