Protein coding transcript 87927

• Transcript: Ll_transcript_344193
• CDS coordinates: 540-1640 (+)
• Peptide sequence: MKDSPMMNGAARKRDGNVTKALLQFRDEDTHPSSNEEATSNVEIASSTMGEVKISLRCSFAVGRPEFRMPSQDQILQMMEEKCLRSYKITDPNFSVPKLLKDICDCMLEFRNDSNDDSQKEFRTTSNVDVMKESDAHGILSGRGNEDPNMLSHTSNGSINVKSSAAMVSPRSPFSVVGMSGLGDAIQASQKDKTTDILESNYSKEPEDPMSPNSHSLPVVPQHNQLTNIKSIHDVNDLTKGEEIVQIPWVNDTTNDFLPPFHYIPQNLVFRDANVSISLSCIGGEDCCSTCMGNCVLLSTQCACADKTGAEFAYTAEGLLKEHFLEECIAISHNPQQHYFYCKDCPLERYKDDGCLEPCKGHLKRKF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_344193

• Blastp: Probable inactive histone-lysine N-methyltransferase SUVR2 from Arabidopsis with 37.65% of identity
• Blastx: Probable inactive histone-lysine N-methyltransferase SUVR2 from Arabidopsis with 37.65% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT5G43990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440971.1)
• Pfam: Pre-SET motif (PF05033.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;