Protein coding transcript 8799

• Transcript: Ll_transcript_504330
• CDS coordinates: 81-617 (+)
• Peptide sequence: MAMKNIEMVLLMSVLVTLWGVTMSQSLECSTTITSLLPCLGYITGKAPTPPPECCTKLASVVGSKPHCLCEIFSGPASSFAKSLHINQTLALGLPAVCNVQTPPISNCNASAPVPAPVSPHAPAPSSHPPSASAPSSHPPSASVPPTQPPSAPVPPTQPPSAPVPPTQPPSAPVPPTQP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_504330

• Blastp: Non-specific lipid-transfer protein-like protein At2g13820 from Arabidopsis with 31.53% of identity
• Blastx: Non-specific lipid-transfer protein-like protein At2g13820 from Arabidopsis with 31.19% of identity
• Eggnog: Non-specific lipid-transfer protein-like protein(ENOG410Z3NP)
• Kegg: Link to kegg annotations (AT2G13820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442361.1)
• Pfam: Probable lipid transfer (PF14368.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;