Protein coding transcript 88050

• Transcript: Ll_transcript_346692
• CDS coordinates: 103-426 (+)
• Peptide sequence: MGILLVYDVTDESSFNNIKNWIRNIEQHASDNVNKILVGNKADMDQSKRAVPTSKGQALADEYGIKFFETSAKTNLNVDEVFFSIARDIKQRLADTDSKAEPQALKIN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_346692

• Blastp: Ras-related protein RABE1c from Arabidopsis with 89.81% of identity
• Blastx: Ras-related protein RABE1a from Arabidopsis with 86.67% of identity
• Eggnog: member RAS oncogene family(ENOG410XPUI)
• Kegg: Link to kegg annotations (AT3G46060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430800.1)
• Pfam: Ras family (PF00071.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;