Protein coding transcript 88051

• Transcript: Ll_transcript_346695
• CDS coordinates: 219-746 (+)
• Peptide sequence: MAATRARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNSNFSSTLNLLSYMPFIILLFSLHTDFPQMCVSLNLYALVEHVLFSVNLMHQVHSDGFQFLCVILYLFLLVSRH*
• ORF Type: complete

Annotations of Ll_transcript_346695

• Blastp: Ras-related protein RAB1BV from Beta with 96.19% of identity
• Blastx: Ras-related protein RABE1e from Arabidopsis with 91.92% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (104900163)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430800.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;