Protein coding transcript 88067

• Transcript: Ll_transcript_345204
• CDS coordinates: 919-1875 (+)
• Peptide sequence: MAFERILFRATRGNVFLRQVVVEDPVIDPVSGEKTEKNVFVVFYAAEKAKSKILKICDAFGANRYPFAEEVGKQTQMIKEVSGRISELKTTIDAGLLHRDNLLQTIGAQFEQWNLLVRKEKSIYHTLNMLSLDVTKKCLVAEGWSPVFATKQVQDALQRAAIDSNSQVSAIVQVLHTRELPPTYFRTNKVTSSFQGIIDSYGVAKYQEANPTVYTVVTFPFLFAVMFGDWGHGICLLLAALYFIIREKKLSSKKLDDITEMTFGGRYVIFLMALFSIYTGVIYNEFFSVPFNIFGPSAYKCRDLSCKDATTVGLIKARR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_345204

• Blastp: V-type proton ATPase subunit a3 from Arabidopsis with 77.04% of identity
• Blastx: V-type proton ATPase subunit a3 from Arabidopsis with 77.81% of identity
• Eggnog: ATPase 116 kDa subunit(COG1269)
• Kegg: Link to kegg annotations (AT4G39080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448472.1)
• Pfam: V-type ATPase 116kDa subunit family (PF01496.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;