Protein coding transcript 88092

• Transcript: Ll_transcript_346376
• CDS coordinates: 1-477 (+)
• Peptide sequence: NATPLINFFKKWTPTGRRLITGSQTGEFTLWNGQSFNFEMILQAHDQAIRSMVWSHNDNWMVSGDDGGAIKYWQNNMNNVKANKSAHKESVRDLSFCRTDLKFCSCSDDTTVKVWDFARCQEESSLTGHGWDVKSVDWHPTKSLLVSGGKDNLVKLWDA
• ORF Type: internal

Annotations of Ll_transcript_346376

• Blastp: Flowering time control protein FY from Arabidopsis with 89.8% of identity
• Blastx: Flowering time control protein FY from Arabidopsis with 89.8% of identity
• Eggnog: wd repeat(COG2319)
• Kegg: Link to kegg annotations (AT5G13480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453491.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;