Protein coding transcript 88093

• Transcript: Ll_transcript_346377
• CDS coordinates: 208-879 (+)
• Peptide sequence: MMYGDPHNHHPHQQQQQQPPPPQHFQHQQQPGPEFHRGPPPPPQMMRQPSASSTNIPPEFHHPAPGGPHPPHYDVHGDIHGAKRMRKLAQRKAVDYTSTVVRYMQIRMSQRDSRDRTVLQPTPAAAIDMLPAVGYSDNPSTSFAAKFVHTSINKNRCPINRVLWTPTGRRLITGSQTGEFTLWNGQSFNFEMILQAHDQAIRSMVWSHNDNWMVSGDDGGAIK*
• ORF Type: complete

Annotations of Ll_transcript_346377

• Blastp: Flowering time control protein FY from Arabidopsis with 41.81% of identity
• Blastx: Flowering time control protein FY from Arabidopsis with 73.58% of identity
• Eggnog: wd repeat(COG2319)
• Kegg: Link to kegg annotations (AT5G13480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413793.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;