Transcript | Ll_transcript_346378 |
---|---|
CDS coordinates | 1882-2946 (+) |
Peptide sequence | MKELESFRGHRKDVTALAWHPFHEEYFVSGSHDGSIFHWLVGHETPQIEVTGAHDNNVWDLAWHPIGYLLCSGSSDHTTKFWCRNRPGDTARDRFNNGMQGYAEQNPVAGRVAGNFAMPEVPTTPGPFPPGLNRNEGTIPGVGVAMPLLDVPQGEQMQPHPASMGAPPLPPGPHPSLLTANQQRPYQQSPQQIPQHQHQGLPQQMGPLPPNMPQLQNPSQSSMVPHPHMPRPPHQMPLGMPGPMSHQMPMPGPMGMQGGMNQMGPPMPQGQYGGMNQMHSGSLPPSGGPPVGVFPGNLPNMQGPPNTSYPQGAFNRPQGGQIPLMQGYNPYQSGNQSGMPPNAQPGAPHSQMPQ* |
ORF Type | complete |
Blastp | Flowering time control protein FY from Arabidopsis with 54.46% of identity |
---|---|
Blastx | Flowering time control protein FY from Arabidopsis with 76.49% of identity |
Eggnog | wd repeat(COG2319) |
Kegg | Link to kegg annotations (AT5G13480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453491.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer