Protein coding transcript 881

• Transcript: Ll_transcript_329354
• CDS coordinates: 2-514 (+)
• Peptide sequence: FELIHLKKLSVNSNKLMFLPSSTSNLVSLKILDARLNCLRSLPEDLENLINLEALNVSQNFRYLDSLPHSLGLLLSLVELDVSYNNIRTLPNSIGCFKKLQKLSVEGNPLISPPLEVVEQGIHVVKEYLCQKINSSHESKPKNMSWVRKLVKCEKFNRYMRSRKKPQHEDD
• ORF Type: internal

Annotations of Ll_transcript_329354

• Blastp: Plant intracellular Ras-group-related LRR protein 6 from Arabidopsis with 61.05% of identity
• Blastx: Plant intracellular Ras-group-related LRR protein 6 from Arabidopsis with 61.05% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT2G19330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431132.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;