Transcript | Ll_transcript_344563 |
---|---|
CDS coordinates | 2922-3224 (+) |
Peptide sequence | MFLLCFRIVEPLVYGDYPISMRTNAGARIPTFTDRESELVKGSYDFIGVIHYININVTDNADILNNKLRDFNVDMAAKIICKYFFTYKNSKFSKRLKLVK* |
ORF Type | complete |
Blastp | Hydroxyisourate hydrolase from Soja with 67.09% of identity |
---|---|
Blastx | Beta-glucosidase 11 from Arabidopsis with 59.46% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (547954) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452637.1) |
Pfam | Glycosyl hydrolase family 1 (PF00232.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer