Protein coding transcript 88133

• Transcript: Ll_transcript_344567
• CDS coordinates: 263-568 (+)
• Peptide sequence: MIMEPETSCFAFMFITILLMNLYVGVLSADKYSRDEFPADFVFGAATSAYQVEGVAKEDGRTPSIWDTFAHAGFFFCLTSSSILLITMDFLNFRSLPSREK*
• ORF Type: complete

Annotations of Ll_transcript_344567

• Blastp: Hydroxyisourate hydrolase from Soja with 62.34% of identity
• Blastx: Beta-glucosidase 11 from Arabidopsis with 59.46% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (547954)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452637.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;