Transcript | Ll_transcript_344571 |
---|---|
CDS coordinates | 263-568 (+) |
Peptide sequence | MIMEPETSCFAFMFITILLMNLYVGVLSADKYSRDEFPADFVFGAATSAYQVEGVAKEDGRTPSIWDTFAHAGFFFCLTSSSILLITMDFLNFRSLPSREK* |
ORF Type | complete |
Blastp | Hydroxyisourate hydrolase from Soja with 62.34% of identity |
---|---|
Blastx | Hydroxyisourate hydrolase from Soja with 81.78% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (547954) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452637.1) |
Pfam | Glycosyl hydrolase family 1 (PF00232.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer