Transcript | Ll_transcript_344556 |
---|---|
CDS coordinates | 367-984 (+) |
Peptide sequence | MVETGLDAYRFSISWSRLIPNGRGPINLKGLQYYNSLINELISNGIQPHVTLHNYDLPQALEDEYGGWISRDIIEDFTNYADACFREFGDRVLYWTTVNEPNVFALGGYGQGTTPPRRCSPPFCLTNSTRGNSTYEPYLAVHHILLAHSSAARLYRIKYRDNQHGYVGISVYTFGRLPQTNTEKDRAANERVRDFIVGWIMEPLVH |
ORF Type | 3prime_partial |
Blastp | Hydroxyisourate hydrolase from Soja with 83.33% of identity |
---|---|
Blastx | Hydroxyisourate hydrolase from Soja with 82.76% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (547954) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452634.1) |
Pfam | Glycosyl hydrolase family 1 (PF00232.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer