Protein coding transcript 88244

• Transcript: Ll_transcript_346463
• CDS coordinates: 112-540 (+)
• Peptide sequence: MAIRAFNPRYSLFSSPTPTLSSFLHRRHTVPRCFRSLPFPPQPPFLSVYRRQIRSVHGLFDSVMEELQAMRKRRKIVSNASKSIMGLLNEELVEDRIVNRSLQKGLLLEFKGDSNRILLVVSQRPDGKKKWMVSDQVLVETT*
• ORF Type: complete

Annotations of Ll_transcript_346463

• Blastp: Ribonuclease II, chloroplastic/mitochondrial from Arabidopsis with 45.78% of identity
• Blastx: Ribonuclease II, chloroplastic/mitochondrial from Arabidopsis with 45.78% of identity
• Eggnog: 3'-5' exoribonuclease that releases 5'-nucleoside monophosphates and is involved in maturation of structured RNAs (By similarity)(COG0557)
• Kegg: Link to kegg annotations (AT5G02250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464581.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;