Transcript | Ll_transcript_346463 |
---|---|
CDS coordinates | 112-540 (+) |
Peptide sequence | MAIRAFNPRYSLFSSPTPTLSSFLHRRHTVPRCFRSLPFPPQPPFLSVYRRQIRSVHGLFDSVMEELQAMRKRRKIVSNASKSIMGLLNEELVEDRIVNRSLQKGLLLEFKGDSNRILLVVSQRPDGKKKWMVSDQVLVETT* |
ORF Type | complete |
Blastp | Ribonuclease II, chloroplastic/mitochondrial from Arabidopsis with 45.78% of identity |
---|---|
Blastx | Ribonuclease II, chloroplastic/mitochondrial from Arabidopsis with 45.78% of identity |
Eggnog | 3'-5' exoribonuclease that releases 5'-nucleoside monophosphates and is involved in maturation of structured RNAs (By similarity)(COG0557) |
Kegg | Link to kegg annotations (AT5G02250) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464581.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer