Protein coding transcript 88245

• Transcript: Ll_transcript_346464
• CDS coordinates: 290-835 (+)
• Peptide sequence: MLTYESASELLHLNLEEEVELKILSEAANLRLNWRRQQGAVDTATLETRVKVSNPESPEPSINIYVENQADPAMRLVSEMMVLCGEAIATFGSRNDIPLPYRGQPQSDINVSEFAHLPEGPVRSFALIKLMRAAEIDFRKPARHGVLGIPGYVQFTSPIRRYLDLLAHYQVSCFQFYHSQV*
• ORF Type: complete

Annotations of Ll_transcript_346464

• Blastp: Ribonuclease II, chloroplastic/mitochondrial from Arabidopsis with 78.16% of identity
• Blastx: Ribonuclease II, chloroplastic/mitochondrial from Arabidopsis with 74.5% of identity
• Eggnog: 3'-5' exoribonuclease that releases 5'-nucleoside monophosphates and is involved in maturation of structured RNAs (By similarity)(COG0557)
• Kegg: Link to kegg annotations (AT5G02250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020204965.1)
• Pfam: RNB domain (PF00773.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;