Protein coding transcript 88270

• Transcript: Ll_transcript_346268
• CDS coordinates: 884-1846 (+)
• Peptide sequence: MGFLKLLEVASVPVIQVLLIGALGAMMSTHYFDHLLSPDFRKSLNKVVFLVFTPSLVFASFAKSVSLADMISWWFMPVNVGLTFFIGGILGWILVKLLKPNLKVEGLIIASCSSGNMGNLPIVIVPAICDEKGGPFGRSDICHNNALSYASFSMALGGIFIWTYTYQTIRSRSMRYKALEAAQIVKIPNKDIDANAETLLLKGEYNQNIVAEVPTSDYIVDTENQSIEEQDQSSVSKNGKESSWYRAIEVLRNFVAELLSPPAIATFFGFLFGTVSWLRNLIVGEDAPFAVIQDTLVLLGYVTLLKESNFSPFFYFFSNY*
• ORF Type: complete

Annotations of Ll_transcript_346268

• Blastp: Protein PIN-LIKES 7 from Arabidopsis with 52.63% of identity
• Blastx: Protein PIN-LIKES 7 from Arabidopsis with 52.63% of identity
• Eggnog: Auxin Efflux Carrier(COG0679)
• Kegg: Link to kegg annotations (AT5G65980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445160.1)
• Pfam: Membrane transport protein (PF03547.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;