Protein coding transcript 88297

• Transcript: Ll_transcript_344271
• CDS coordinates: 2-391 (+)
• Peptide sequence: VAVKQLDQNGLQGNREFLVEVLMLSLLHHSNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDWNTRMKIAAGAAKGLEYLHDKANPPVIYRDLKSPNILLDKGYHPKLSDFGMAKLGPVG
• ORF Type: internal

Annotations of Ll_transcript_344271

• Blastp: Receptor-like cytoplasmic kinase 185 from Oryza sativa with 93.08% of identity
• Blastx: Receptor-like cytoplasmic kinase 185 from Oryza sativa with 93.08% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (4338592)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004486047.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;