Transcript | Ll_transcript_344273 |
---|---|
CDS coordinates | 302-862 (+) |
Peptide sequence | MGRCFPCFGSSNKEGKKNGVKEVVAKKESFKDASIPQSQYPTRVSSDKSKSQSGSDPKKEIPVAKNGPTAHIAAQTFTFRELAVATKNFRPECLLGEGGFGRVYKGRLENTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVKLIGYCADGDQRLLVYEFMPLGSLEDRLHEKYVPVFVFI* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase PBL27 from Arabidopsis with 75.14% of identity |
---|---|
Blastx | Serine/threonine-protein kinase PBL27 from Arabidopsis with 91.67% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT5G18610) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020989866.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer