Transcript | Ll_transcript_344256 |
---|---|
CDS coordinates | 302-871 (+) |
Peptide sequence | MGRCFPCFGSSNKEGKKNGVKEVVAKKESFKDASIPQSQYPTRVSSDKSKSQSGSDPKKEIPVAKNGPTAHIAAQTFTFRELAVATKNFRPECLLGEGGFGRVYKGRLENTGQVVAVKQLDRNGLQGNREFLVEVLMLSLLHHPNLVKLIGYCADGDQRLLVYEFMPLGSLEDRLHGEIRSFLTETFIS* |
ORF Type | complete |
Blastp | Serine/threonine-protein kinase PBL27 from Arabidopsis with 75.57% of identity |
---|---|
Blastx | Serine/threonine-protein kinase PBL27 from Arabidopsis with 73.86% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT5G18610) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439715.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer