Protein coding transcript 88312

• Transcript: Ll_transcript_344264
• CDS coordinates: 774-1199 (+)
• Peptide sequence: MKIAAGAARGLEYLHDKANPPVIYRDLKSSNILLDEGYYPKLSDFGLAKLGPVGDKTHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVFLELITGRKAIDNARSHGEHNLVAWARPLFKDRRKFPKMADPLLQGHYPI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_344264

• Blastp: Serine/threonine-protein kinase PBL27 from Arabidopsis with 92.96% of identity
• Blastx: Serine/threonine-protein kinase PBL27 from Arabidopsis with 91.67% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G18610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020989866.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;