Transcript | Ll_transcript_344272 |
---|---|
CDS coordinates | 1348-1713 (+) |
Peptide sequence | MQGDLGIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIKIVGGDHRLRNYSSTITVHPEVIDGRPGTMVIESFVVDVPDGNTRDETCYFVEALIRCNLSSLADVSERMAVQGRTDPLNL* |
ORF Type | complete |
Blastp | Abscisic acid receptor PYL9 from Arabidopsis with 85.59% of identity |
---|---|
Blastx | Abscisic acid receptor PYL9 from Arabidopsis with 84.78% of identity |
Eggnog | abscisic acid receptor(ENOG4111HU5) |
Kegg | Link to kegg annotations (AT1G01360) |
CantataDB | Link to cantataDB annotations (CNT0000974) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455529.1) |
Pfam | Polyketide cyclase / dehydrase and lipid transport (PF10604.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer