Protein coding transcript 88314

• Transcript: Ll_transcript_344272
• CDS coordinates: 1348-1713 (+)
• Peptide sequence: MQGDLGIGSVREVNVKSGLPATTSTERLEQLDDEEHILGIKIVGGDHRLRNYSSTITVHPEVIDGRPGTMVIESFVVDVPDGNTRDETCYFVEALIRCNLSSLADVSERMAVQGRTDPLNL*
• ORF Type: complete

Annotations of Ll_transcript_344272

• Blastp: Abscisic acid receptor PYL9 from Arabidopsis with 85.59% of identity
• Blastx: Abscisic acid receptor PYL9 from Arabidopsis with 84.78% of identity
• Eggnog: abscisic acid receptor(ENOG4111HU5)
• Kegg: Link to kegg annotations (AT1G01360)
• CantataDB: Link to cantataDB annotations (CNT0000974)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455529.1)
• Pfam: Polyketide cyclase / dehydrase and lipid transport (PF10604.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;