Protein coding transcript 88315

• Transcript: Ll_transcript_344283
• CDS coordinates: 278-835 (+)
• Peptide sequence: MMNGGDVIAIETQYIRRHHKHEPRDNQCTSALVKHIKAPVHLVWSLVRRFDQPQKYKPFVSRCITQGDLGIGSVREVNVKSGLPATTSTERLEQLDDEEHIFGIKIVGGDHRLRNYSSTITVHPEVIDGRPGTMVIESFVVDVPDGNTKDETCYFVEALIRCNLSSLADVSERMAVQGRTDPLNL*
• ORF Type: complete

Annotations of Ll_transcript_344283

• Blastp: Abscisic acid receptor PYL9 from Arabidopsis with 81.36% of identity
• Blastx: Abscisic acid receptor PYL9 from Arabidopsis with 81.36% of identity
• Eggnog: abscisic acid receptor(ENOG4111HU5)
• Kegg: Link to kegg annotations (AT1G01360)
• CantataDB: Link to cantataDB annotations (CNT0000974)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461065.1)
• Pfam: Polyketide cyclase / dehydrase and lipid transport (PF10604.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;