Protein coding transcript 88322

• Transcript: Ll_transcript_347036
• CDS coordinates: 58-609 (+)
• Peptide sequence: MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHTKPTISPTILLSNMYQRPDMNININFNGSDPNQPPPPEPPQSQSQSQSSLDPDKVQDHFEDFYQDLFQELSKYGQIQSLNICDNLADHMVGNVYVQFKEEDHAANALMNLTGRFYSGAHYSSFILKGCYIVKYVFNSSSRNHFLLF*
• ORF Type: complete

Annotations of Ll_transcript_347036

• Blastp: Splicing factor U2af small subunit B from Arabidopsis with 70.78% of identity
• Blastx: Splicing factor U2af small subunit B from Arabidopsis with 68.39% of identity
• Eggnog: auxiliary factor(ENOG410Z5PX)
• Kegg: Link to kegg annotations (AT5G42820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444288.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;