Protein coding transcript 88363

• Transcript: Ll_transcript_345459
• CDS coordinates: 148-1191 (+)
• Peptide sequence: MRRRRETASAEASKESSSGEAIDKSSDGGAKVYTNVHIANPRRSSFVWLALFLIITYCCTAIYNYQFQSMPVPLTADQAGKRGFSEIEAFKHVKALTEVGPHPVSSDALNLALQYVLEACQTINKTAHWEVDVEVDLFHAKSGANRLASGLFMGRTLVYSDLSHVVVRILPKYLSDAKEHSILVSSHIDTVFSTEGAGDCSSCVGVMLELARGVSQWAHGLKRGVIFLFNTGEEEGLDGAHSFITQHPWSNTVRMAIDLEAMGIGGKSSIFQAGPHPWAIEKFALVAKYPSGQIISQDLFSSGAIKSATDFQVYKEVAGLSGLDFAYVDNTAVYHTKVSFPSYCFTK*
• ORF Type: complete

Annotations of Ll_transcript_345459

• Blastp: Endoplasmic reticulum metallopeptidase 1 from Homo with 31.01% of identity
• Blastx: Endoplasmic reticulum metallopeptidase 1 from Homo with 35.5% of identity
• Eggnog: peptidase m28(COG2234)
• Kegg: Link to kegg annotations (79956)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452698.1)
• Pfam: Peptidase family M28 (PF04389.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;