Transcript | Ll_transcript_345647 |
---|---|
CDS coordinates | 42-410 (+) |
Peptide sequence | MGLTKENLLSQLKDLQIEFSKYEHPVVLTVEAQAKYVGHLGGGLSKNLFLKDKKNRFYVVSALADTKVDLKVLSQRLGLGKGGLRMAPEEALGDILQVPLGSVTPFALVNESARYVTWEHFI* |
ORF Type | complete |
Blastp | Prolyl-tRNA synthetase associated domain-containing protein 1 from Xenopus with 45.05% of identity |
---|---|
Blastx | Prolyl-tRNA synthetase associated domain-containing protein 1 from Xenopus with 45.45% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (431901) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417887.1) |
Pfam | Aminoacyl-tRNA editing domain (PF04073.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer