Protein coding transcript 88389

• Transcript: Ll_transcript_345651
• CDS coordinates: 42-410 (+)
• Peptide sequence: MGLTKENLLSQLKDLQIEFSKYEHPVVLTVEAQAKYVGHLGGGLSKNLFLKDKKNRFYVVSALADTKVDLKVLSQRLGLGKGGLRMAPEEALGDILQVPLGSVTPFALVNESARYVTWEHFI*
• ORF Type: complete

Annotations of Ll_transcript_345651

• Blastp: Prolyl-tRNA synthetase associated domain-containing protein 1 from Xenopus with 45.05% of identity
• Blastx: Prolyl-tRNA synthetase associated domain-containing protein 1 from Xenopus with 45.45% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (431901)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417887.1)
• Pfam: Aminoacyl-tRNA editing domain (PF04073.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;