Protein coding transcript 88390

• Transcript: Ll_transcript_345660
• CDS coordinates: 42-629 (+)
• Peptide sequence: MGLTKENLLSQLKDLQIEFSKYEHPVVLTVEAQAKYVGHLGGGLSKNLFLKDKKNRFYVVSALADTKVDLKVLSQRLGLGKGGLRMAPEEALGDILQVPLGSVTPFALVNESARDVSLLLDQGFKTQEHCFFHPLSNDVSISLNARDLDKFFKAIGRDPSYVDLEASPKVGKDEPPDLAALVPSGSIVLPDQPEKQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_345660

• Blastp: Prolyl-tRNA synthetase associated domain-containing protein 1 from Xenopus with 38.92% of identity
• Blastx: Prolyl-tRNA synthetase associated domain-containing protein 1 from Xenopus with 38.46% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (431901)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417887.1)
• Pfam: Aminoacyl-tRNA editing domain (PF04073.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;