Protein coding transcript 88456

• Transcript: Ll_transcript_346287
• CDS coordinates: 2-367 (+)
• Peptide sequence: DLMTDLLGTPPAESIARIRNEKAKRYLSSMRKKQPVPLSQKFPKADPLALSLLERLLAFDPKDRPSAEEALADPYFNGLSNIDCEPSTQPISKLEFEFERRRLTKDDVRELIYREILEYHPQ
• ORF Type: internal

Annotations of Ll_transcript_346287

• Blastp: Mitogen-activated protein kinase 15 from Arabidopsis with 81.97% of identity
• Blastx: Mitogen-activated protein kinase 15 from Arabidopsis with 81.97% of identity
• Eggnog: Mitogen-activated protein kinase(ENOG410XNY0)
• Kegg: Link to kegg annotations (AT1G73670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446153.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;