Protein coding transcript 88457

• Transcript: Ll_transcript_346303
• CDS coordinates: 3-416 (+)
• Peptide sequence: LTGKPLFPGKNVVHQLDLMTDLLGTPPAESIARIRNEKARRYLSSMRKKQPIPLTEKFPNADPLALSTLERLLAFDPKDRPTAEEALADPYFNGLSNIDREPSTHPISKLEFEFERRKLMKDDVRELIYREILEYHPQ
• ORF Type: internal

Annotations of Ll_transcript_346303

• Blastp: Mitogen-activated protein kinase 14 from Oryza sativa with 78.26% of identity
• Blastx: Mitogen-activated protein kinase 14 from Oryza sativa with 78.26% of identity
• Eggnog: Mitogen-activated protein kinase(ENOG410XNY0)
• Kegg: Link to kegg annotations (9267958)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424386.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;