Protein coding transcript 88528

• Transcript: Ll_transcript_346655
• CDS coordinates: 2866-3729 (+)
• Peptide sequence: MVKSKSVDTISPLRKEDGQRGNFVDRGVGSPRLVKCSSSNTFTTSKNSIPEAAGAVAAAAIADQMLGPKEDRHLAIVMVSLPARGKTYTAAKLARYLRWLGHDTKHFNVGKYRRLRHGTNQSSDFFRADNPQGMDARNEVAVLAFEDMISWMQEGGQVGIFDATNSSKQRRKTLMKLAEGRCKIIFLETICNDVDIIERNIRLKIQQSPDYAEVQDFESGLRDFKDRVANYEKVYETVEEGSYIKMIDMASGHGGQIQVTGIIYSLVSHRQLRQVRKTHQSDPKFCS*
• ORF Type: complete

Annotations of Ll_transcript_346655

• Blastp: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase from Arabidopsis with 76.89% of identity
• Blastx: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase from Arabidopsis with 73.14% of identity
• Eggnog: Phosphoglycerate mutase(COG0406)
• Kegg: Link to kegg annotations (AT1G07110)
• CantataDB: Link to cantataDB annotations (CNT0002894)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456566.1)
• Pfam: 6-phosphofructo-2-kinase (PF01591.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;