Protein coding transcript 88559

• Transcript: Ll_transcript_345362
• CDS coordinates: 366-791 (+)
• Peptide sequence: MQVLNSKLVTNSDAVMLPTSVKSVILYEGSITKFGSKLHGFDIGTCLEVIEHMDEDQACLFGDVALSYFCPQILIVSTPNFEYNVVLQKSSMTNQEQEDESDEKSLLQSCKFRNHDHKFEWTREQFQQWASDIAARHNYKVK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_345362

• Blastp: Small RNA 2'-O-methyltransferase from Arabidopsis with 62.3% of identity
• Blastx: Small RNA 2'-O-methyltransferase from Arabidopsis with 61.79% of identity
• Eggnog: Methyltransferase(ENOG410XSD6)
• Kegg: Link to kegg annotations (AT4G20910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458770.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;