Transcript | Ll_transcript_345362 |
---|---|
CDS coordinates | 366-791 (+) |
Peptide sequence | MQVLNSKLVTNSDAVMLPTSVKSVILYEGSITKFGSKLHGFDIGTCLEVIEHMDEDQACLFGDVALSYFCPQILIVSTPNFEYNVVLQKSSMTNQEQEDESDEKSLLQSCKFRNHDHKFEWTREQFQQWASDIAARHNYKVK |
ORF Type | 3prime_partial |
Blastp | Small RNA 2'-O-methyltransferase from Arabidopsis with 62.3% of identity |
---|---|
Blastx | Small RNA 2'-O-methyltransferase from Arabidopsis with 61.79% of identity |
Eggnog | Methyltransferase(ENOG410XSD6) |
Kegg | Link to kegg annotations (AT4G20910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458770.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer