Transcript | Ll_transcript_345910 |
---|---|
CDS coordinates | 746-1120 (+) |
Peptide sequence | MGCCSKFYLVLLLSIYVGVSLASLLEDQKRDKITKLPGQPGNVGFDQYSGYITVNEQRERALFYWLVEAPLNRRPHSRPLVLWLNGGPGCSSVAYGASEEIGPFRIRPDGKTLFVNPYAWNNCK* |
ORF Type | complete |
Blastp | Serine carboxypeptidase-like 27 from Arabidopsis with 73% of identity |
---|---|
Blastx | Serine carboxypeptidase-like 26 from Arabidopsis with 45.55% of identity |
Eggnog | carboxy-peptidase(COG2939) |
Kegg | Link to kegg annotations (AT3G07990) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441943.1) |
Pfam | Serine carboxypeptidase (PF00450.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer