Transcript | Ll_transcript_345116 |
---|---|
CDS coordinates | 692-1072 (+) |
Peptide sequence | MLGKGHAALLKRAELKTFVNFHGNEAGKGGDLTHDETTIITGALELTEKTAKDAMTPISKAFSLDLDATLNLDTLNTIMTLGHSRVPVFAGDPSNIIGLVLVKNLFMVDSKAAVPLRKMIIRKIPR* |
ORF Type | complete |
Blastp | DUF21 domain-containing protein At1g47330 from Arabidopsis with 78.57% of identity |
---|---|
Blastx | DUF21 domain-containing protein At1g47330 from Arabidopsis with 76.5% of identity |
Eggnog | CBS Domain protein(COG1253) |
Kegg | Link to kegg annotations (AT1G47330) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432495.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer