Protein coding transcript 88620

• Transcript: Ll_transcript_345120
• CDS coordinates: 918-1475 (+)
• Peptide sequence: MTLGHSRVPVFAGDPSNIIGLVLVKNLFMVDSKAAVPLRKMIIRKIPRVSENMPLYDILNEFQKGHSHIAVVYKDLNDKKDTPKRVKDRERYDFKDSCKNKGEMAPLDKSVKSQSGDTLTTIAKVDGSPKVKKSSPANPAPAFKKRHRGCSHCILDVDNAPLLVFPPNEVVVGVITMEDVIEELLQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_345120

• Blastp: DUF21 domain-containing protein At1g47330 from Arabidopsis with 55.84% of identity
• Blastx: DUF21 domain-containing protein At1g47330 from Arabidopsis with 80% of identity
• Eggnog: CBS Domain protein(COG1253)
• Kegg: Link to kegg annotations (AT1G47330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432496.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;