Protein coding transcript 88702

• Transcript: Ll_transcript_346776
• CDS coordinates: 1-579 (+)
• Peptide sequence: GDDGFRGEGSLGIRVGMPLGLNLEQGAFMRHQQGHDVEGNITNSHNQHHQQQLLRLNHNGNNNNNSTSQSSSYTAGINDKDMQIRGMFSGFGQMQNPPPTHAHARSIRPTLLSPQPPLHHHQQPFQNQPRPPMSVAAMPQHPPGIRPRVRARRGQATDPHSIAERVRLAFFFFSLHVLWFLAFVIDSQWLKV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_346776

• Blastp: Transcription factor UNE12 from Arabidopsis with 65.22% of identity
• Blastx: Transcription factor bHLH66 from Arabidopsis with 76.56% of identity
• Eggnog: Transcription factor(ENOG410YBM7)
• Kegg: Link to kegg annotations (AT4G02590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453575.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;