Protein coding transcript 88704

• Transcript: Ll_transcript_346778
• CDS coordinates: 1-354 (+)
• Peptide sequence: PRVRARRGQATDPHSIAERLRRERIAERMKSLQELVPSINKTDRAAMLDEIMEYVKFLRLQVKVLSMSRMGTAGTIAQLVSDVPLSVVEVISLENTMLLFLLHNLYIISIYTLLLLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_346778

• Blastp: Transcription factor bHLH82 from Arabidopsis with 84.42% of identity
• Blastx: Transcription factor bHLH7 from Arabidopsis with 82.56% of identity
• Eggnog: Transcription factor(ENOG4111MVP)
• Kegg: Link to kegg annotations (AT5G58010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429166.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;