Protein coding transcript 88708

• Transcript: Ll_transcript_346795
• CDS coordinates: 441-1658 (+)
• Peptide sequence: MAGNGSEGLGDDFFEQILAVPEASYGRSLSHDVGSIPMGLQLGSTSGGLRGGGSLGIGVGMPLGLNLEQGAFLRHQGGHDVEGSINNNHNQHQQHQQLLRLNNNNNHNGNNNSNNNSTSSSSSSTAGINFVCGWQDKDMQMRGMFSGLGQLHNNPPPPIHAHAHSIRPTLLSPQPQLHHHHQQAFQSQAQPPVSAAAMPQQPPGIRPRVRARRGQATDPHSIAERLRRERIAERMKALQELVPSINKTDRAAMLDEIMEYVKFLRLQVKVLSMSRLGGAGAVAQLVSDVPFSAVEVINLENIMLLFLYFMFFYIISTYSYFYLYQALNYTRNFFNSYVFGISTFAFTCCIFMHVESKLHYNRKIVYLVTWRSGFIKQTTFLFVRVRLHVCIYLLFRTLLNWSLVH*
• ORF Type: complete

Annotations of Ll_transcript_346795

• Blastp: Transcription factor UNE12 from Arabidopsis with 79.63% of identity
• Blastx: Transcription factor UNE12 from Arabidopsis with 86.52% of identity
• Eggnog: Transcription factor(ENOG410YBM7)
• Kegg: Link to kegg annotations (AT4G02590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429165.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;