| Transcript | Ll_transcript_346763 |
|---|---|
| CDS coordinates | 204-590 (+) |
| Peptide sequence | MKSLQELVPSINKTDRAAMLDEIMEYVKFLRLQVKVLSMSRMGTAGTIAQLVSDVPLSVVEGVEIEGGENQQAWDKWSNDGTEQKVAKLMKEDVGAAMQFLQSKALCIIPISLASNIFHMPQSEASTL* |
| ORF Type | complete |
| Blastp | Transcription factor UNE12 from Arabidopsis with 72.03% of identity |
|---|---|
| Blastx | Transcription factor UNE12 from Arabidopsis with 63.43% of identity |
| Eggnog | Transcription factor(ENOG410YBM7) |
| Kegg | Link to kegg annotations (AT4G02590) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019429166.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer