Transcript | Ll_transcript_345266 |
---|---|
CDS coordinates | 142-1275 (+) |
Peptide sequence | MAQYGPRVVVPIDLKKKPWEQKFPLHNRWHPDIPTVEVVTAGEVFRIEMVDFSGGGITKNYTAHDIKHVDLSIVHYLSGPIRVMDSDGILAKPGDLLVVEICNLGPLPGDEWGYTGTFDRENGGGFLTDHFPCATKAIWHFEGIYAHSPQIPGVRFPGLTHPGIIGTAPSMELLNIWNEREKDVEENGIESFKLCEVLHSRPLANLPSTNGCHLGKIQKGTAEWEKIAKEAARTIPGRENGGNCDIKNLSRGSKIYLPVFVEGANLSTGDMHFSQGDGEVSFCGAIEMSGFLELKCEIIRGGMKEYLTPMGPTPLHVNPIFEIGPVEPRFSEWLVFEGISVDESGRQHYLDASVAYKRAVLNAIDYLSKFGYSKEQV* |
ORF Type | complete |
Blastp | Formamidase from Methylophilus with 49.33% of identity |
---|---|
Blastx | Formamidase from Methylophilus with 49.33% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000428) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424281.1) |
Pfam | Acetamidase/Formamidase family (PF03069.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer