Protein coding transcript 88746

• Transcript: Ll_transcript_345241
• CDS coordinates: 414-1037 (+)
• Peptide sequence: MELLNIWNEREKDVEENGIESFKLCEVLHSRPLANLPSTNGCHLGKIQKGTAEWEKIAKEAARTIPGRENGGNCDIKNLSRGSKIYLPVFVEGANLSTGDMHFSQGDGEVSFCGAIEMSGFLELKCEIIRGGMKEYLTPMGPTPLHVNPIFEIGPVEPRFSEWLVFEGISVDESGRQHYLDASVAYKRAVLNAIDYLSKFGYSKEQV*
• ORF Type: complete

Annotations of Ll_transcript_345241

• Blastp: Formamidase from Methylophilus with 47.8% of identity
• Blastx: Formamidase from Methylophilus with 47.84% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000428)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423858.1)
• Pfam: Acetamidase/Formamidase family (PF03069.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;