Protein coding transcript 88794

• Transcript: Ll_transcript_345487
• CDS coordinates: 1392-1841 (+)
• Peptide sequence: MEINASYDIELSRSTERMQHELWPLDPVDPKKAKFPCCLVWNPLPVVSWLAPFIGHVGLCREDGVVLDFSGSNFVNIDEFAFGAVARYVQLDRRQCCFPPNLSAHTCKHSYRHTENGTAITWDDALQSTMRYFDNKTYNLFTCNCHSFVA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_345487

• Blastp: Protein REVERSION-TO-ETHYLENE SENSITIVITY1 from Arabidopsis with 62.42% of identity
• Blastx: Protein REVERSION-TO-ETHYLENE SENSITIVITY1 from Arabidopsis with 62.42% of identity
• Eggnog: Transmembrane protein 222(ENOG4111G1S)
• Kegg: Link to kegg annotations (AT2G26070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437741.1)
• Pfam: Protein of unknown function (DUF778) (PF05608.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;