Protein coding transcript 88888

• Transcript: Ll_transcript_345415
• CDS coordinates: 115-633 (+)
• Peptide sequence: MNVHIVYMDIMRPFAESVLSGFIDKGPSVNDRWIFDSPVHSNVEAKLRQLLIELGSNDKILGIQVCAYKDGEVIIDTAAGVLGKYDPRPVKSDSLFPVFSVTKGITAGMMHWLVDNGKLSLGENVTNIWPGFGSNGKDSIKVHHVLNHTSGLHNAMADVTRENPLLMSDWDEC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_345415

• Blastp: Beta-lactamase domain-containing protein 2 from Caenorhabditis with 30.17% of identity
• Blastx: Beta-lactamase domain-containing protein 2 from Caenorhabditis with 34.07% of identity
• Eggnog: Beta-lactamase(COG1680)
• Kegg: Link to kegg annotations (CELE_ZK945.1)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438814.1)
• Pfam: Beta-lactamase (PF00144.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;