Transcript | Ll_transcript_345403 |
---|---|
CDS coordinates | 610-1185 (+) |
Peptide sequence | MMHWLVDNGKLNLAENVANIWPGFGSNGKDFIKVHHVLNHTSGLHNAMTDITRENPLLMSDWDECLNHICKSVPETEPGKEQFYHYLSFGWLCGGIIEHASGKKFQEILEEAIVRPLHIEGEMYVGIPPGVESRLAALTVDTDDLRKLAGLTGRPDLPSSFQPQQIAQLATTLPPLFNTLHARRAIIPAANG |
ORF Type | 3prime_partial |
Blastp | Beta-lactamase domain-containing protein 2 from Caenorhabditis with 26.81% of identity |
---|---|
Blastx | Beta-lactamase domain-containing protein 2 from Caenorhabditis with 27.42% of identity |
Eggnog | Beta-lactamase(COG1680) |
Kegg | Link to kegg annotations (CELE_ZK945.1) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458336.1) |
Pfam | Beta-lactamase (PF00144.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer