| Transcript | Ll_transcript_293656 |
|---|---|
| CDS coordinates | 3-326 (+) |
| Peptide sequence | KRYITTKREAESTIASKFPKMRSFFVRPGFLYDSSRGFTIPMAALTYGGFIANSLTGGNLTWLMGAGGSKPLKADLVAESVIEGLSDDGIKGPVETQEIEMLANRAWR |
| ORF Type | internal |
| Blastp | Uncharacterized protein C1840.09 from Schizosaccharomyces with 42.86% of identity |
|---|---|
| Blastx | Uncharacterized protein C1840.09 from Schizosaccharomyces with 42.86% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPCC1840.09) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003612805.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer