Protein coding transcript 88905

• Transcript: Ll_transcript_345693
• CDS coordinates: 352-705 (+)
• Peptide sequence: MHERKAEMAKHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPKARNIIVSAPSTKELVKKMEEYFPQHERVASKLSWENGQPEYSCSD*
• ORF Type: complete

Annotations of Ll_transcript_345693

• Blastp: Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3 from Arabidopsis with 86.84% of identity
• Blastx: Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 from Arabidopsis with 79.02% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT2G37210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413629.1)
• Pfam: Possible lysine decarboxylase (PF03641.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;