Protein coding transcript 88907

• Transcript: Ll_transcript_345695
• CDS coordinates: 352-687 (+)
• Peptide sequence: MHERKAEMAKHSDAFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVEEGFISPKARHIIVSAPSTKELVRKMEEYFPQHERVASKLSWENGQLE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_345695

• Blastp: Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 from Arabidopsis with 87.39% of identity
• Blastx: Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1 from Arabidopsis with 78.47% of identity
• Eggnog: decarboxylase(COG1611)
• Kegg: Link to kegg annotations (AT2G28305)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448745.1)
• Pfam: Possible lysine decarboxylase (PF03641.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;